RID: X5XU776D016 Job Title:NP_005359:myoglobin isoform 1 [Homo sapiens] Program: BLASTP Database: nr_clustered(experimental) clustered nr Query #1: myoglobin isoform 1 [Homo sapiens] Query ID: ref|NP_005359.1 Length: 154 Clusters producing significant alignments: <@acc_hd@><@sciname_hd@><@comname_hd@><@taxid_hd@> Cluster: Q0KIY6.3 RecName: Full=Myoglobin-2; AltName: Full=Nitrite reductase MB;... Num Members: 0 Num Taxa: 0 Scientific Name: Common Name : Taxid: 0 Highest Bit Score: 275 Total Bit Score: 275 Percent Coverage: 100% % Evalue: 1e-95 Percent Identity: 85.71 % Accession Length: 154 0 cluster member(s): <@clust_mem_rows@> Cluster: NP_001277651.1 myoglobin [Physeter macrocephalus] Num Members: 153 Num Taxa: 25 Scientific Name: Cetacea Common Name : whales Taxid: 9721 Highest Bit Score: 273 Total Bit Score: 273 Percent Coverage: 100% Evalue: 4e-95 Percent Identity: 84.42% Accession Length: 154 153 cluster member(s): Accession Scientific Common Taxid NP_001277651.1 Physeter macrocephalus sperm whale 9755 101M_A Physeter macrocephalus sperm whale 9755 102M_A Physeter macrocephalus sperm whale 9755 104M_A Physeter macrocephalus sperm whale 9755 106M_A Physeter macrocephalus sperm whale 9755 109M_A Physeter macrocephalus sperm whale 9755 1A6G_A Physeter macrocephalus sperm whale 9755 1A6K_A Physeter macrocephalus sperm whale 9755 1CH1_A Physeter macrocephalus sperm whale 9755 1CH2_A Physeter macrocephalus sperm whale 9755 1CH3_A Physeter macrocephalus sperm whale 9755 1CH5_A Physeter macrocephalus sperm whale 9755 1CH7_A Physeter macrocephalus sperm whale 9755 1CH9_A Physeter macrocephalus sperm whale 9755 1CIK_A Physeter macrocephalus sperm whale 9755 1CIO_A Physeter macrocephalus sperm whale 9755 1CO8_A Physeter macrocephalus sperm whale 9755 1CO9_A Physeter macrocephalus sperm whale 9755 1CP0_A Physeter macrocephalus sperm whale 9755 1CP5_A Physeter macrocephalus sperm whale 9755 1CPW_A Physeter macrocephalus sperm whale 9755 1DO1_A Physeter macrocephalus sperm whale 9755 1DTI_A Physeter macrocephalus sperm whale 9755 1DTM_A Physeter macrocephalus sperm whale 9755 1DXC_A Physeter macrocephalus sperm whale 9755 1FCS_A Physeter macrocephalus sperm whale 9755 1H1X_A Physeter macrocephalus sperm whale 9755 1IRC_A Physeter macrocephalus sperm whale 9755 1J3F_A Physeter macrocephalus sperm whale 9755 1JDO_A Physeter macrocephalus sperm whale 9755 1LTW_A Physeter macrocephalus sperm whale 9755 1LUE_A Physeter macrocephalus sperm whale 9755 1MCY_A Physeter macrocephalus sperm whale 9755 1MGN_A Physeter macrocephalus sperm whale 9755 1MLF_A Physeter macrocephalus sperm whale 9755 1MLM_A Physeter macrocephalus sperm whale 9755 1MLQ_A Physeter macrocephalus sperm whale 9755 1MLU_A Physeter macrocephalus sperm whale 9755 1MOB_A Physeter macrocephalus sperm whale 9755 1MOC_A Physeter macrocephalus sperm whale 9755 1MTI_A Physeter macrocephalus sperm whale 9755 1O16_A Physeter macrocephalus sperm whale 9755 1OBM_A Physeter macrocephalus sperm whale 9755 1OFJ_A Physeter macrocephalus sperm whale 9755 1OFK_A Physeter macrocephalus sperm whale 9755 1WVP_A Physeter macrocephalus sperm whale 9755 2BLH_A Physeter macrocephalus sperm whale 9755 2E2Y_A Physeter macrocephalus sperm whale 9755 2MGC_A Physeter macrocephalus sperm whale 9755 2MGF_A Physeter macrocephalus sperm whale 9755 2MGJ_A Physeter macrocephalus sperm whale 9755 2OH8_A Physeter macrocephalus sperm whale 9755 2OH9_A Physeter macrocephalus sperm whale 9755 2OHA_A Physeter macrocephalus sperm whale 9755 2OHB_A Physeter macrocephalus sperm whale 9755 2SPO_A Physeter macrocephalus sperm whale 9755 2W6X_A Physeter macrocephalus sperm whale 9755 2W6Y_A Physeter macrocephalus sperm whale 9755 3A2G_A Physeter macrocephalus sperm whale 9755 3H57_A Physeter macrocephalus sperm whale 9755 3K9Z_A Physeter macrocephalus sperm whale 9755 3M38_A Physeter macrocephalus sperm whale 9755 3MN0_A Physeter macrocephalus sperm whale 9755 3NML_A Physeter macrocephalus sperm whale 9755 3O89_A Physeter macrocephalus sperm whale 9755 3SDN_A Physeter macrocephalus sperm whale 9755 4FWX_A Physeter macrocephalus sperm whale 9755 4FWZ_A Physeter macrocephalus sperm whale 9755 4H07_A Physeter macrocephalus sperm whale 9755 4IT8_A Physeter macrocephalus sperm whale 9755 4LPI_A Physeter macrocephalus sperm whale 9755 4OF9_A Physeter macrocephalus sperm whale 9755 4OOD_A Physeter macrocephalus sperm whale 9755 4PQ6_A Physeter macrocephalus sperm whale 9755 4PQB_A Physeter macrocephalus sperm whale 9755 4PQC_A Physeter macrocephalus sperm whale 9755 4QAU_A Physeter macrocephalus sperm whale 9755 4TYX_A Physeter macrocephalus sperm whale 9755 5B84_A Physeter macrocephalus sperm whale 9755 5B85_A Physeter macrocephalus sperm whale 9755 5HLQ_A Physeter macrocephalus sperm whale 9755 5KD1_A Physeter macrocephalus sperm whale 9755 5OJ9_A Physeter macrocephalus sperm whale 9755 5OJA_A Physeter macrocephalus sperm whale 9755 5OJB_A Physeter macrocephalus sperm whale 9755 5OJC_A Physeter macrocephalus sperm whale 9755 5UTB_A Physeter macrocephalus sperm whale 9755 5UTD_A Physeter macrocephalus sperm whale 9755 5XKV_A Physeter macrocephalus sperm whale 9755 5XKW_A Physeter macrocephalus sperm whale 9755 5YCI_A Physeter macrocephalus sperm whale 9755 5YZF_A Physeter macrocephalus sperm whale 9755 5ZEO_A Physeter macrocephalus sperm whale 9755 5ZZF_A Physeter macrocephalus sperm whale 9755 6D45_A Physeter macrocephalus sperm whale 9755 6F17_A Physeter macrocephalus sperm whale 9755 6G5A_A Physeter macrocephalus sperm whale 9755 6G5T_A Physeter macrocephalus sperm whale 9755 6JP1_A Physeter macrocephalus sperm whale 9755 6KRC_A Physeter macrocephalus sperm whale 9755 6M8F_A Physeter macrocephalus sperm whale 9755 6Z4R_A Physeter macrocephalus sperm whale 9755 6Z4T_A Physeter macrocephalus sperm whale 9755 742482A Physeter macrocephalus sperm whale 9755 7CEZ_A Physeter macrocephalus sperm whale 9755 7EHX_A Physeter macrocephalus sperm whale 9755 7KYR_A Physeter macrocephalus sperm whale 9755 7L3U_A Physeter macrocephalus sperm whale 9755 7SLH_A Physeter macrocephalus sperm whale 9755 7SLI_A Physeter macrocephalus sperm whale 9755 7SPE_A Physeter macrocephalus sperm whale 9755 7SPG_A Physeter macrocephalus sperm whale 9755 7VUC_A Physeter macrocephalus sperm whale 9755 7VW4_A Physeter macrocephalus sperm whale 9755 7XC9_A Physeter macrocephalus sperm whale 9755 7XCF_A Physeter macrocephalus sperm whale 9755 7XCQ_A Physeter macrocephalus sperm whale 9755 7YLK_A Physeter macrocephalus sperm whale 9755 8EKO_A Physeter macrocephalus sperm whale 9755 8KFH_A Physeter macrocephalus sperm whale 9755 8KFI_A Physeter macrocephalus sperm whale 9755 8KFJ_A Physeter macrocephalus sperm whale 9755 8QBA_A Physeter macrocephalus sperm whale 9755 8XBJ_A Physeter macrocephalus sperm whale 9755 9DTH_A Physeter macrocephalus sperm whale 9755 9LMB_A Physeter macrocephalus sperm whale 9755 9P1E_A Physeter macrocephalus sperm whale 9755 AMN15042.1 Tursiops truncatus common bottlenose dolphin 9739 AMN15044.1 Delphinus capensis long-beaked common dolphin 103584 AMN15049.1 Balaenoptera acutorostrata minke whale 9767 P02178.2 Megaptera novaeangliae humpback whale 9773 P02180.2 Balaenoptera physalus Fin whale 9770 P02181.2 Inia geoffrensis boutu 9725 P02182.2 Ziphius cavirostris Cuvier's beaked whale 9760 P02184.2 Kogia sima dwarf sperm whale 9752 P83682.2 Delphinapterus leucas beluga whale 9749 Q0KIY3.3 Peponocephala electra melon-headed whale 103596 Q0KIY6.3 Stenella attenuata bridled dolphin 9735 Q0KIY9.3 Indopacetus pacificus Longman's beaked whale 221924 R9RZK8.1 Balaena mysticetus bowhead whale 27602 XP_004286254.1 Orcinus orca killer whale 9733 XP_007165766.1 Balaenoptera acutorostrata minke whale 9767 XP_007456317.1 Lipotes vexillifer Yangtze River dolphin 118797 XP_022455612.1 Delphinapterus leucas beluga whale 9749 XP_024599230.1 Neophocaena asiaeorientalis... Yangtze finless porpoise 1706337 XP_026964057.1 Sagmatias obliquidens Pacific white-sided dolphin 3371155 XP_029061405.1 Monodon monoceros narwhal 40151 XP_030711254.1 Globicephala melas long-finned pilot whale 9731 XP_036722853.1 Balaenoptera musculus blue whale 9771 XP_058936780.1 Kogia breviceps pygmy sperm whale 27615 XP_059969141.1 Mesoplodon densirostris Blainville's beaked whale 48708 XP_061060968.1 Eubalaena glacialis North Atlantic right whale 27606 XP_079571984.1 Hyperoodon ampullatus northern bottlenose whale 48744 Cluster: Q0KIY9.3 RecName: Full=Myoglobin; AltName: Full=Nitrite reductase MB;... Num Members: 0 Num Taxa: 0 Scientific Name: Common Name : Taxid: 0 Highest Bit Score: 271 Total Bit Score: 271 Percent Coverage: 100% % Evalue: 1e-94 Percent Identity: 85.71 % Accession Length: 154 0 cluster member(s): <@clust_mem_rows@> Cluster: 101M_A Chain A, MYOGLOBIN Num Members: 0 Num Taxa: 0 Scientific Name: Common Name : Taxid: 0 Highest Bit Score: 270 Total Bit Score: 270 Percent Coverage: 100% % Evalue: 1e-93 Percent Identity: 83.12 % Accession Length: 154 0 cluster member(s): <@clust_mem_rows@> Cluster: P83682.2 RecName: Full=Myoglobin; AltName: Full=Nitrite reductase MB;... Num Members: 0 Num Taxa: 0 Scientific Name: Common Name : Taxid: 0 Highest Bit Score: 253 Total Bit Score: 253 Percent Coverage: 100% % Evalue: 4e-87 Percent Identity: 81.17 % Accession Length: 154 0 cluster member(s): <@clust_mem_rows@> Cluster: MBV97686.1 Myoglobin [Eschrichtius robustus] Num Members: 1 Num Taxa: 1 Scientific Name: Eschrichtius robustus Common Name : grey whale Taxid: 9764 Highest Bit Score: 224 Total Bit Score: 224 Percent Coverage: 80% Evalue: 4e-76 Percent Identity: 87.10% Accession Length: 132 1 cluster member(s): Accession Scientific Common Taxid MBV97686.1 Eschrichtius robustus grey whale 9764 Cluster: AMN15048.1 myoglobin, partial [Mesoplodon densirostris] Num Members: 0 Num Taxa: 0 Scientific Name: Common Name : Taxid: 0 Highest Bit Score: 194 Total Bit Score: 194 Percent Coverage: 68% % Evalue: 1e-64 Percent Identity: 89.62 % Accession Length: 106 0 cluster member(s): <@clust_mem_rows@> Cluster: KAB0400357.1 hypothetical protein E2I00_010453 [Balaenoptera physalus] Num Members: 1 Num Taxa: 1 Scientific Name: Balaenoptera physalus Common Name : Fin whale Taxid: 9770 Highest Bit Score: 193 Total Bit Score: 193 Percent Coverage: 70% Evalue: 1e-63 Percent Identity: 83.49% Accession Length: 153 1 cluster member(s): Accession Scientific Common Taxid KAB0400357.1 Balaenoptera physalus Fin whale 9770 Cluster: NP_001071055.1 cytoglobin [Canis lupus familiaris] Num Members: 42 Num Taxa: 38 Scientific Name: Theria Common Name : mammals Taxid: 32525 Highest Bit Score: 76.3 Total Bit Score: 76.3 Percent Coverage: 95% Evalue: 3e-17 Percent Identity: 29.33% Accession Length: 183 42 cluster member(s): Accession Scientific Common Taxid NP_001071055.1 Canis lupus familiaris dog 9615 KAB0362316.1 Muntiacus muntjak muntjak 9888 KAF4012862.1 Cervus hanglu yarkandensis Yarkand deer 84702 KAI4533865.1 Ovis ammon polii argali 230172 KAL4687106.1 Pygathrix nigripes Black-shanked douc langur 310352 NP_001244859.1 Macaca mulatta Rhesus monkey 9544 XP_001377108.2 Monodelphis domestica gray short-tailed opossum 13616 XP_003786147.1 Otolemur garnettii small-eared galago 30611 XP_004432860.1 Ceratotherium simum simum southern white rhinoceros 73337 XP_004454515.1 Dasypus novemcinctus nine-banded armadillo 9361 XP_004748898.1 Mustela putorius furo domestic ferret 9669 XP_008587107.1 Galeopterus variegatus Sunda flying lemur 482537 XP_010385819.1 Rhinopithecus roxellana golden snub-nosed monkey 61622 XP_012517720.1 Propithecus coquereli Coquerel's sifaka 379532 XP_013217133.1 Ictidomys tridecemlineatus thirteen-lined ground squirrel 43179 XP_019601195.1 Rhinolophus sinicus Chinese rufous horseshoe bat 89399 XP_020018091.1 Castor canadensis American beaver 51338 XP_020858230.1 Phascolarctos cinereus koala 38626 XP_020858232.1 Phascolarctos cinereus koala 38626 XP_022379087.1 Enhydra lutris kenyoni northern sea otter 391180 XP_027729103.1 Vombatus ursinus common wombat 29139 XP_027729105.1 Vombatus ursinus common wombat 29139 XP_030683621.1 Nomascus leucogenys northern white-cheeked gibbon 61853 XP_031821730.1 Sarcophilus harrisii Tasmanian devil 9305 XP_031821731.1 Sarcophilus harrisii Tasmanian devil 9305 XP_032032807.1 Hylobates moloch silvery gibbon 81572 XP_032726424.1 Lontra canadensis Northern American river otter 76717 XP_032945642.1 Rhinolophus ferrumequinum greater horseshoe bat 59479 XP_036609498.1 Trichosurus vulpecula common brushtail 9337 XP_043441593.1 Prionailurus bengalensis leopard cat 37029 XP_043820168.1 Dromiciops gliroides monito del monte 33562 XP_044529583.1 Gracilinanus agilis Agile Gracile Mouse Opossum 191870 XP_051850975.1 Antechinus flavipes yellow-footed antechinus 38775 XP_051850976.1 Antechinus flavipes yellow-footed antechinus 38775 XP_053424653.1 Nycticebus coucang slow loris 9470 XP_058415419.1 Diceros bicornis minor black rhinoceros 77932 XP_058904130.1 Kogia breviceps pygmy sperm whale 27615 XP_067573337.1 Pseudorca crassidens false killer whale 82174 XP_069849036.1 Dipodomys merriami Merriam's kangaroo rat 94247 XP_070082067.1 Equus caballus horse 9796 XP_074080589.1 Macrotis lagotis bilby 92651 XP_074116916.1 Sminthopsis crassicaudata fat-tailed dunnart 9301 Cluster: XP_045381714.1 cytoglobin isoform X2 [Lemur catta] Num Members: 0 Num Taxa: 0 Scientific Name: Common Name : Taxid: 0 Highest Bit Score: 74.3 Total Bit Score: 74.3 Percent Coverage: 95% % Evalue: 2e-16 Percent Identity: 28.67 % Accession Length: 200 0 cluster member(s): <@clust_mem_rows@> Cluster: TKC53449.1 hypothetical protein EI555_014904 [Monodon monoceros] Num Members: 1 Num Taxa: 1 Scientific Name: Monodon monoceros Common Name : narwhal Taxid: 40151 Highest Bit Score: 74.7 Total Bit Score: 74.7 Percent Coverage: 95% Evalue: 3e-16 Percent Identity: 29.33% Accession Length: 235 1 cluster member(s): Accession Scientific Common Taxid TKC53449.1 Monodon monoceros narwhal 40151 Cluster: XP_032472711.1 LOW QUALITY PROTEIN: cytoglobin [Phocoena sinus] Num Members: 1 Num Taxa: 1 Scientific Name: Phocoena sinus Common Name : vaquita Taxid: 42100 Highest Bit Score: 73.2 Total Bit Score: 73.2 Percent Coverage: 95% Evalue: 1e-15 Percent Identity: 29.33% Accession Length: 269 1 cluster member(s): Accession Scientific Common Taxid XP_032472711.1 Phocoena sinus vaquita 42100 Cluster: XP_030693643.1 cytoglobin isoform X2 [Globicephala melas] Num Members: 0 Num Taxa: 0 Scientific Name: Common Name : Taxid: 0 Highest Bit Score: 68.2 Total Bit Score: 68.2 Percent Coverage: 84% % Evalue: 5e-14 Percent Identity: 30.08 % Accession Length: 200 0 cluster member(s): <@clust_mem_rows@> Cluster: XP_030693645.1 cytoglobin isoform X4 [Globicephala melas] Num Members: 0 Num Taxa: 0 Scientific Name: Common Name : Taxid: 0 Highest Bit Score: 63.9 Total Bit Score: 63.9 Percent Coverage: 83% % Evalue: 1e-12 Percent Identity: 29.01 % Accession Length: 189 0 cluster member(s): <@clust_mem_rows@> Cluster: KAB0400714.1 hypothetical protein E2I00_008341 [Balaenoptera physalus] Num Members: 1 Num Taxa: 1 Scientific Name: Balaenoptera physalus Common Name : Fin whale Taxid: 9770 Highest Bit Score: 63.5 Total Bit Score: 63.5 Percent Coverage: 78% Evalue: 1e-12 Percent Identity: 30.65% Accession Length: 168 1 cluster member(s): Accession Scientific Common Taxid KAB0400714.1 Balaenoptera physalus Fin whale 9770 Alignments: >RecName: Full=Myoglobin-2; AltName: Full=Nitrite reductase MB; AltName: Full=Pseudoperoxidase MB Sequence ID: Q0KIY6.3 Length: 154 Range 1: 1 to 154 Score:275 bits(702), Expect:1e-95, Method:Compositional matrix adjust., Identities:132/154(86%), Positives:143/154(92%), Gaps:0/154(0%) Query 1 MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60 MGLSDGEWQLVLNVWGKVEAD+ GHGQ+VLIRLFKGHPETLEKFDKFKHLK+E +MKASE Sbjct 1 MGLSDGEWQLVLNVWGKVEADLAGHGQDVLIRLFKGHPETLEKFDKFKHLKTEADMKASE 60 Query 61 DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH 120 DLKKHG TVLTALG ILKKKGHH+AE+KPLAQSHATKHKIP+KYLEFISE II VL S+H Sbjct 61 DLKKHGNTVLTALGAILKKKGHHDAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120 Query 121 PGDFGADAQGAMNKALELFRKDMASNYKELGFQG 154 P +FGADAQ AMNKALELFRKD+A+ YKELGF G Sbjct 121 PAEFGADAQAAMNKALELFRKDIATKYKELGFHG 154 >myoglobin [Physeter macrocephalus] Sequence ID: NP_001277651.1 Length: 154 Range 1: 1 to 154 Score:273 bits(698), Expect:4e-95, Method:Compositional matrix adjust., Identities:130/154(84%), Positives:143/154(92%), Gaps:0/154(0%) Query 1 MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60 M LS+GEWQLVL+VW KVEAD+ GHGQ++LIRLFK HPETLEKFD+FKHLK+E EMKASE Sbjct 1 MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60 Query 61 DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH 120 DLKKHG TVLTALG ILKKKGHHEAE+KPLAQSHATKHKIP+KYLEFISE II VL S+H Sbjct 61 DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120 Query 121 PGDFGADAQGAMNKALELFRKDMASNYKELGFQG 154 PGDFGADAQGAMNKALELFRKD+A+ YKELG+QG Sbjct 121 PGDFGADAQGAMNKALELFRKDIAAKYKELGYQG 154 >RecName: Full=Myoglobin; AltName: Full=Nitrite reductase MB; AltName: Full=Pseudoperoxidase MB Sequence ID: Q0KIY9.3 Length: 154 Range 1: 1 to 154 Score:271 bits(694), Expect:1e-94, Method:Compositional matrix adjust., Identities:132/154(86%), Positives:141/154(91%), Gaps:0/154(0%) Query 1 MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60 MGLS+ EWQLVL+VW KVEAD+ GHGQE+LIRLFKGHPETLEKFDKFKHLKSE EMKASE Sbjct 1 MGLSEAEWQLVLHVWAKVEADLSGHGQEILIRLFKGHPETLEKFDKFKHLKSEAEMKASE 60 Query 61 DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH 120 DLKKHG TVLTALGGILKKKGHHEAE+KPLAQSHATKHKIP+KYLEFIS+ II VL SKH Sbjct 61 DLKKHGHTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKH 120 Query 121 PGDFGADAQGAMNKALELFRKDMASNYKELGFQG 154 P DFGADAQ AM KALELFRKD+A+ YKELGF G Sbjct 121 PSDFGADAQAAMTKALELFRKDIAAKYKELGFHG 154 >Chain A, MYOGLOBIN Sequence ID: 101M_A Length: 154 Range 1: 1 to 154 Score:270 bits(689), Expect:1e-93, Method:Compositional matrix adjust., Identities:128/154(83%), Positives:142/154(92%), Gaps:0/154(0%) Query 1 MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60 M LS+GEWQLVL+VW KVEAD+ GHGQ++LIRLFK HPETLEKFD+ KHLK+E EMKASE Sbjct 1 MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRVKHLKTEAEMKASE 60 Query 61 DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH 120 DLKKHG TVLTALG ILKKKGHHEAE+KPLAQSHATKHKIP+KYLEFISE II VL S+H Sbjct 61 DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120 Query 121 PGDFGADAQGAMNKALELFRKDMASNYKELGFQG 154 PG+FGADAQGAMNKALELFRKD+A+ YKELG+QG Sbjct 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154 >RecName: Full=Myoglobin; AltName: Full=Nitrite reductase MB; AltName: Full=Pseudoperoxidase MB Sequence ID: P83682.2 Length: 154 Range 1: 1 to 154 Score:253 bits(645), Expect:4e-87, Method:Compositional matrix adjust., Identities:125/154(81%), Positives:135/154(87%), Gaps:0/154(0%) Query 1 MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60 MGLS+GEWQLVL KVEAD+ GHGQ+VLIRLFKGHPETLEKFDKFKHLK+ MKASE Sbjct 1 MGLSEGEWQLVLXXXXKVEADLAGHGQDVLIRLFKGHPETLEKFDKFKHLKTXXXMKASE 60 Query 61 DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH 120 DLKKHG TVLTALGGILKKKGHHEAE+KPLAQSHATKHKIP+KYL E II VL S+H Sbjct 61 DLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLXXXXEAIIHVLHSRH 120 Query 121 PGDFGADAQGAMNKALELFRKDMASNYKELGFQG 154 P +FGADAQGAMNKALELFRKD+A+ YKELGF G Sbjct 121 PAEFGADAQGAMNKALELFRKDIAAKYKELGFHG 154 >Myoglobin [Eschrichtius robustus] Sequence ID: MBV97686.1 Length: 132 Range 1: 9 to 132 Score:224 bits(571), Expect:4e-76, Method:Compositional matrix adjust., Identities:108/124(87%), Positives:117/124(94%), Gaps:0/124(0%) Query 31 IRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPL 90 ++LFKGHPETLEKFDKFKHLK+E EMKASEDLKKHG TVLTALGGILKKKGHHEAE+KPL Sbjct 9 VKLFKGHPETLEKFDKFKHLKTEAEMKASEDLKKHGNTVLTALGGILKKKGHHEAELKPL 68 Query 91 AQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKEL 150 AQSHATKHKIP+KYLEFIS+ II VL S+HPGDFGADAQ AMNKALELFRKD+A+ YKEL Sbjct 69 AQSHATKHKIPIKYLEFISDAIIHVLHSRHPGDFGADAQAAMNKALELFRKDIAAKYKEL 128 Query 151 GFQG 154 GFQG Sbjct 129 GFQG 132 >myoglobin, partial [Mesoplodon densirostris] Sequence ID: AMN15048.1 Length: 106 Range 1: 1 to 106 Score:194 bits(494), Expect:1e-64, Method:Compositional matrix adjust., Identities:95/106(90%), Positives:101/106(95%), Gaps:0/106(0%) Query 1 MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60 MGLS+ EWQLVL+VW KVEAD+ GHGQE+LIRLFKGHPETLEKFDKFKHLKSE EMKASE Sbjct 1 MGLSEAEWQLVLHVWAKVEADLSGHGQEILIRLFKGHPETLEKFDKFKHLKSEAEMKASE 60 Query 61 DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLE 106 DLKKHG TVLTALGGILKKKGHHEAE+KPLAQSHATKHKIP+KYLE Sbjct 61 DLKKHGHTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLE 106 >hypothetical protein E2I00_010453 [Balaenoptera physalus] Sequence ID: KAB0400357.1 Length: 153 Range 1: 1 to 109 Score:193 bits(491), Expect:1e-63, Method:Compositional matrix adjust., Identities:91/109(83%), Positives:100/109(91%), Gaps:0/109(0%) Query 1 MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60 M L+D EW LVLN+W KVEAD+ GHGQ++LI LFKGHPETLEKFDKFKHLK+E EMKASE Sbjct 1 MVLTDAEWHLVLNIWAKVEADVAGHGQDILISLFKGHPETLEKFDKFKHLKTEAEMKASE 60 Query 61 DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFIS 109 DLKKHG TVLTALGGILKKKGHHEAE+KPLAQSHATKHKIP+KYLE +S Sbjct 61 DLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEVVS 109 >cytoglobin [Canis lupus familiaris] Sequence ID: NP_001071055.1 Length: 183 Range 1: 15 to 164 Score:76.3 bits(186), Expect:3e-17, Method:Compositional matrix adjust., Identities:44/150(29%), Positives:73/150(48%), Gaps:3/150(2%) Query 6 GEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKH 65 E + V W ++ A+ G +L+R F P + F +FKH+ EM+ S L+KH Sbjct 15 AERKAVQATWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMTEPLEMERSPQLRKH 74 Query 66 GATVLTALGGILKKKGHHEAEIKPLA---QSHATKHKIPVKYLEFISECIIQVLQSKHPG 122 V+ AL +++ E LA ++HA KHK+ Y + +S I++V+ + Sbjct 75 ACRVMGALNTVVENLHDPEKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVIAEEFAN 134 Query 123 DFGADAQGAMNKALELFRKDMASNYKELGF 152 DF + Q A K L + + YKE+G+ Sbjct 135 DFPPETQRAWAKLRSLIYSHVTAAYKEVGW 164 >cytoglobin isoform X2 [Lemur catta] Sequence ID: XP_045381714.1 Length: 200 Range 1: 22 to 171 Score:74.3 bits(181), Expect:2e-16, Method:Compositional matrix adjust., Identities:43/150(29%), Positives:74/150(49%), Gaps:3/150(2%) Query 6 GEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKH 65 E + V W ++ A+ G +L+R F P + F +FKH++ EM+ S L+KH Sbjct 22 AERKAVQATWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEEPLEMERSPQLRKH 81 Query 66 GATVLTALGGILKKKGHHEAEIKPLA---QSHATKHKIPVKYLEFISECIIQVLQSKHPG 122 V+ AL +++ + LA ++HA KHK+ Y + +S I++V+ + Sbjct 82 ACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVIAEEFAN 141 Query 123 DFGADAQGAMNKALELFRKDMASNYKELGF 152 DF + Q A K L + + YKE+G+ Sbjct 142 DFPPETQRAWTKLRGLIYSHVTAAYKEVGW 171 >hypothetical protein EI555_014904 [Monodon monoceros] Sequence ID: TKC53449.1 Length: 235 Range 1: 22 to 171 Score:74.7 bits(182), Expect:3e-16, Method:Compositional matrix adjust., Identities:44/150(29%), Positives:74/150(49%), Gaps:3/150(2%) Query 6 GEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKH 65 E + V W ++ A+ G +L+R F P + F +FKH++ EM+ S L+KH Sbjct 22 AERKAVQATWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEEPLEMERSPQLRKH 81 Query 66 GATVLTALGGILKKKGHHEAEIKPLA---QSHATKHKIPVKYLEFISECIIQVLQSKHPG 122 V+ AL +++ E LA ++HA KHK+ Y + +S I++V+ + Sbjct 82 ACRVMGALNTVVENLHDPEKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVIAEEFAN 141 Query 123 DFGADAQGAMNKALELFRKDMASNYKELGF 152 DF + Q A K L + + YKE+G+ Sbjct 142 DFPPETQRAWAKLRGLIYSHVTAAYKEVGW 171 >LOW QUALITY PROTEIN: cytoglobin [Phocoena sinus] Sequence ID: XP_032472711.1 Length: 269 Range 1: 101 to 250 Score:73.2 bits(178), Expect:1e-15, Method:Compositional matrix adjust., Identities:44/150(29%), Positives:73/150(48%), Gaps:3/150(2%) Query 6 GEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKH 65 E + V W ++ A G +L+R F P + F +FKH++ EM+ S L+KH Sbjct 101 AERKAVQATWARLYAKCXDVGVAILVRFFVNFPSAKQYFSQFKHMEEPLEMERSPQLRKH 160 Query 66 GATVLTALGGILKKKGHHEAEIKPLA---QSHATKHKIPVKYLEFISECIIQVLQSKHPG 122 V+ AL +++ E LA ++HA KHK+ Y + +S I++V+ + Sbjct 161 ACRVMGALNTVVENLHDPEKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVIAEEFAN 220 Query 123 DFGADAQGAMNKALELFRKDMASNYKELGF 152 DF + Q A K L + + YKE+G+ Sbjct 221 DFPPETQRAWAKLRGLIYSHVTAAYKEVGW 250 >cytoglobin isoform X2 [Globicephala melas] Sequence ID: XP_030693643.1 Length: 200 Range 1: 49 to 181 Score:68.2 bits(165), Expect:5e-14, Method:Compositional matrix adjust., Identities:40/133(30%), Positives:65/133(48%), Gaps:3/133(2%) Query 23 PGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGH 82 P +V R F P + F +FKH++ EM+ S L+KH V+ AL +++ Sbjct 49 PAGSSQVRCRFFVNFPSAKQYFSQFKHMEEPLEMERSPQLRKHACRVMGALNTVVENLHD 108 Query 83 HEAEIKPLA---QSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELF 139 E LA ++HA KHK+ Y + +S I++V+ + DF + Q A K L Sbjct 109 PEKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVIAEEFANDFPPETQRAWAKLRGLI 168 Query 140 RKDMASNYKELGF 152 + + YKE+G+ Sbjct 169 YSHVTAAYKEVGW 181 >cytoglobin isoform X4 [Globicephala melas] Sequence ID: XP_030693645.1 Length: 189 Range 1: 27 to 157 Score:63.9 bits(154), Expect:1e-12, Method:Compositional matrix adjust., Identities:38/131(29%), Positives:64/131(48%), Gaps:3/131(2%) Query 27 QEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAE 86 + + R F P + F +FKH++ EM+ S L+KH V+ AL +++ E Sbjct 27 RPAVCRFFVNFPSAKQYFSQFKHMEEPLEMERSPQLRKHACRVMGALNTVVENLHDPEKV 86 Query 87 IKPLA---QSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDM 143 LA ++HA KHK+ Y + +S I++V+ + DF + Q A K L + Sbjct 87 SSVLALVGKAHALKHKVEPVYFKILSGVILEVIAEEFANDFPPETQRAWAKLRGLIYSHV 146 Query 144 ASNYKELGFQG 154 + YKE+G+ Sbjct 147 TAAYKEVGWPA 157 >hypothetical protein E2I00_008341 [Balaenoptera physalus] Sequence ID: KAB0400714.1 Length: 168 Range 1: 11 to 134 Score:63.5 bits(153), Expect:1e-12, Method:Compositional matrix adjust., Identities:38/124(31%), Positives:62/124(50%), Gaps:3/124(2%) Query 32 RLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLA 91 R F P + F +FKH++ EM+ S L+KH V+ AL +++ E LA Sbjct 11 RFFVNFPSAKQYFSQFKHMEEPLEMERSPQLRKHACRVMGALNTVVENLHDPEKVSSVLA 70 Query 92 ---QSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYK 148 ++HA KHK+ Y + +S I++V+ + DF + Q A K L + + YK Sbjct 71 LVGKAHALKHKVEPVYFKILSGVILEVIAEEFANDFPPETQRAWAKLRGLLYSHVTAAYK 130 Query 149 ELGF 152 E+G+ Sbjct 131 EVGW 134